PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim04g071510.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 309aa    MW: 33874.1 Da    PI: 7.273
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim04g071510.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.91.2e-14225274251
                         XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         ++l+r+rr++kNRe+A rsR+RK+a++ eLe  +  Le+eN++L ke ee
  Sopim04g071510.0.1 225 AALQRQRRMIKNRESAARSRERKQAYQVELESIAVRLEEENEQLLKEKEE 274
                         689*****************************************998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-9224286IPR004827Basic-leucine zipper domain
PfamPF001703.7E-13225274IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.45226277IPR004827Basic-leucine zipper domain
CDDcd147073.71E-16228274No hitNo description
SuperFamilySSF579591.62E-9228278No hitNo description
Gene3DG3DSA:1.20.5.1705.2E-12229275No hitNo description
PROSITE patternPS000360231246IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MASTKLMASS ASRNSDRRKS SAASSSSSST MPNDLLNQQY SNNGSNNSSN LEATSMTVDG  60
FLRNVYGEGQ GTEANTLLNA NITLLDAAGA ITPISDSETA TVSGIPLVRR TVDDVWREIV  120
EGKREQRRAA VAGCKEEAVD EIMTLEDFLV KAGAVEEEAL AGEGPVQGEV KVELGTERLS  180
GGIFAFDSPY MAMPQQSVQG YGNGIDVIGG GRGKRKAILE PLDKAALQRQ RRMIKNRESA  240
ARSRERKQAY QVELESIAVR LEEENEQLLK EKEERTRAHY KQIIEKVIPV VEKRKPPRVL  300
RRVCSMQW*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4682490.0CU468249.6 S.lycopersicum DNA sequence from clone LE_HBa-94K6 on chromosome 4, complete sequence.
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237796.10.0PREDICTED: G-box-binding factor 4 isoform X1
SwissprotP427775e-52GBF4_ARATH; G-box-binding factor 4
TrEMBLK4BTE30.0K4BTE3_SOLLC; Uncharacterized protein
STRINGSolyc04g071510.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27712452
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.11e-37G-box binding factor 4